MyTaq

Polymerases & Mixes

Monoclonal Antibody For Equine

genesig Easy kit for Equine dermatophytosis
R00963 50 tests
EUR 410
Description: Equine dermatophytosis

Equine Antibody Laboratories manufactures the monoclonal antibody for equine reagents distributed by Genprice. The Monoclonal Antibody For Equine reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact equine Antibody. Other Monoclonal products are available in stock. Specificity: Monoclonal Category: Antibody Group: For Equine

True Blue
5x5(mg
EUR 2705

True Blue Chloride
100mg
EUR 11200
Description: 71431-30-6

JBS True Blue
300µl
EUR 11.84

JBS True Blue
300 µl
EUR 16
Description: JBS True Blue

genesig Easy kit for Equine dermatophytosis
50 tests
EUR 410
Description: Equine dermatophytosis

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

For Equine information

Monoclonal antibody for Kv3.2
SMC-492D-DY633 0.1mg
EUR 466.8
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with Dylight 633.

Monoclonal antibody for Kv3.2
SMC-492D-FITC 0.1mg
EUR 469.2
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with FITC.

Monoclonal antibody for Kv3.2
SMC-492D-HRP 0.1mg
EUR 464.4
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with HRP.

Monoclonal antibody for Kv3.2
SMC-492D-P594 0.1mg
EUR 487.2
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with PE/ATTO 594.

Monoclonal antibody for Kv3.2
SMC-492D-PCP 0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with PerCP.

Monoclonal antibody for Kv3.2
SMC-492D-RPE 0.1mg
EUR 475.2
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with RPE.

Monoclonal antibody for Kv3.2
SMC-492D-STR 0.1mg
EUR 476.4
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with Streptavidin.

Monoclonal antibody for Kv3.2
SMC-492S 0.012mg
EUR 78
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is not conjugated.

Monoclonal antibody for p23
SMC-156D-A565 0.1mg
EUR 417.6
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with ATTO 565.

Monoclonal antibody for p23
SMC-156D-A633 0.1mg
EUR 417.6
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with ATTO 633.

Monoclonal antibody for p23
SMC-156D-A655 0.1mg
EUR 417.6
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with ATTO 655.

Monoclonal antibody for p23
SMC-156D-A680 0.1mg
EUR 417.6
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with ATTO 680.

Monoclonal antibody for p23
SMC-156D-A700 0.1mg
EUR 417.6
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with ATTO 700.

Monoclonal antibody for p23
SMC-156D-APCCY7 0.1mg
EUR 502.8
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with APC/Cy7.

Monoclonal antibody for p23
SMC-156D-DY350 0.1mg
EUR 434.4
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with Dylight 350.

Monoclonal antibody for p23
SMC-156D-DY405 0.1mg
EUR 421.2
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with Dylight 405.

Monoclonal antibody for p23
SMC-156D-DY488 0.1mg
EUR 409.2
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with Dylight 488.